Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMA3 polyclonal antibody (A01)

  • Catalog # : H00003909-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LAMA3.
  • Immunogen:
  • LAMA3 (NP_000218, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SSQQQRVPFLQPPGQSQLQASYVEFRPSQGCSPGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNSFATGCV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003909-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3909
  • Gene Name:
  • LAMA3
  • Gene Alias:
  • BM600,E170,LAMNA,LOCS,lama3a
  • Gene Description:
  • laminin, alpha 3
  • Gene Summary:
  • Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • BM600 150kD subunit,epiligrin 170 kda subunit,epiligrin alpha 3 subunit,kalinin 165kD subunit,laminin alpha 3 subunit,laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin),laminin-5 alpha 3 chain,nicein 150kD subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook