LAMA2 monoclonal antibody (M01), clone 2D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LAMA2.
Immunogen
LAMA2 (NP_000417, 3013 a.a. ~ 3122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to LAMA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAMA2 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — LAMA2
Entrez GeneID
3908GeneBank Accession#
NM_000426Protein Accession#
NP_000417Gene Name
LAMA2
Gene Alias
LAMM
Gene Description
laminin, alpha 2
Gene Ontology
HyperlinkGene Summary
Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. This gene encodes the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the cause of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000017189|laminin M|laminin alpha 2 subunit|merosin heavy chain
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Integration of single-nuclei RNA-sequencing, spatial transcriptomics and histochemistry defines the complex microenvironment of NF1-associated plexiform neurofibromas.
Vladimir Amani, Kent A Riemondy, Rui Fu, Andrea M Griesinger, Enrique Grimaldo, Graziella Ribeiro De Sousa, Ahmed Gilani, Molly Hemenway, Nicholas K Foreman, Andrew M Donson, Nicholas Willard.
Acta Neuropathologica Communications 2023 Sep; 11(1):158.
Application:IHC, Human, Human plexiform neurofibroma.
-
A coordinated approach for the assessment of molecular subgroups in pediatric ependymomas using low-cost methods.
Graziella Ribeiro de Sousa, Régia Caroline Peixoto Lira, Taciani de Almeida Magalhães, Keteryne Rodrigues da Silva, Luis Fernando Peinado Nagano, Fabiano Pinto Saggioro, Mirella Baroni, Suely Kazue Nagahashi Marie, Sueli Mieko Oba-Shinjo, Silvia Brandelise, Rosane Gomes de Paula Queiroz, María Sol Brassesco, Carlos Alberto Scrideli, Luiz Gonzaga Tone, Elvis Terci Valera.
Journal of Molecular Medicine (Berlin, Germany) 2021 Aug; 99(8):1101.
Application:IHC-Fr, IHC-P, Human, Human ependymoma.
-
Micro-laminin gene therapy can function as an inhibitor of muscle disease in the dyW mouse model of MDC1A.
Davin Packer, Paul T Martin.
Molecular Therapy. Methods & Clinical Development 2021 Feb; 9(21):805.
Application:WB, ELISA, Mouse, Muscle, CHO cells.
-
Review of ependymomas: assessment of consensus in pathological diagnosis and correlations with genetic profiles and outcome.
Sasaki A, Hirato J, Hirose T, Fukuoka K, Kanemura Y, Hashimoto N, Kodama Y, Ichimura K, Sakamoto H, Nishikawa R.
Brain Tumor Pathology 2019 Apr; 6(2):92.
Application:IHC-P, Human, Human ependymoma.
-
Chromosome 1q gain and tenascin-C expression are candidate markers to define different risk groups in pediatric posterior fossa ependymoma.
Araki A, Chocholous M, Gojo J, Dorfer C, Czech T, Heinzl H, Dieckmann K, Ambros IM, Ambros PF, Slavc I, Haberler C.
Acta Neuropathologica Communications 2016 Aug; 4(1):88.
Application:IHC, Human, Ependymoma.
-
Altered MicroRNA Expression Is Associated with Tumor Grade, Molecular Background and Outcome in Childhood Infratentorial Ependymoma.
Zakrzewska M, Fendler W, Zakrzewski K, Sikorska B, Grajkowska W, Dembowska-Baginska B, Filipek I, Stefanczyk L, Liberski PP.
PLoS One 2016 Jul; 11(7):e0158464.
Application:IHC-P, Human, Ependymoma.
-
Advanced Intimal Hyperplasia Without Luminal Narrowing of Leptomeningeal Arteries in CADASIL.
Dong H, Ding H, Young K, Blaivas M, Christensen PJ, Wang MM.
Stroke 2013 May; 44(5):1456.
Application:IHC-P, Human, Human brains.
-
Quiescent fibroblasts exhibit high metabolic activity.
Lemons JM, Feng XJ, Bennett BD, Legesse-Miller A, Johnson EL, Raitman I, Pollina EA, Rabitz HA, Rabinowitz JD, Coller HA.
PLoS Biology 2010 Oct; 8(10):e1000514.
Application:WB, Human, CI14 fibroblasts.
-
Integration of single-nuclei RNA-sequencing, spatial transcriptomics and histochemistry defines the complex microenvironment of NF1-associated plexiform neurofibromas.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com