LAG3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
LAG3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LAG3 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of LAG3 expression in transfected 293T cell line (H00003902-T02) by LAG3 MaxPab polyclonal antibody.
Lane 1: LAG3 transfected lysate(39.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LAG3 protein.
Immunogen
LAG3 (AAH52589.1, 1 a.a. ~ 360 a.a) full-length human protein.
Sequence
MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (68)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
LAG3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LAG3 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of LAG3 expression in transfected 293T cell line (H00003902-T02) by LAG3 MaxPab polyclonal antibody.
Lane 1: LAG3 transfected lysate(39.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LAG3
Entrez GeneID
3902GeneBank Accession#
BC052589Protein Accession#
AAH52589.1Gene Name
LAG3
Gene Alias
CD223
Gene Description
lymphocyte-activation gene 3
Omim ID
153337Gene Ontology
HyperlinkGene Summary
Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. [provided by RefSeq
Other Designations
lymphocyte-activation protein 3
-
Interactome
-
Disease
-
Publication Reference
-
CRYAB modulates the activation of CD4+ T cells from relapsing-remitting multiple sclerosis patients.
Quach QL, Metz LM, Thomas JC, Rothbard JB, Steinman L, Ousman SS.
Multiple Sclerosis (Houndmills, Basingstoke, England) 2012 Dec; 19(14):1867.
Application：WB, Human, Human T cells.
-
CRYAB modulates the activation of CD4+ T cells from relapsing-remitting multiple sclerosis patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com