KRT16 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KRT16 polyclonal antibody (A01), Lot # 060118JC01 Western Blot analysis of KRT16 expression in 293 ( Cat # L026V1 ).
Western Blot detection against Immunogen (36.89 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant KRT16.
Immunogen
KRT16 (NP_005548, 301 a.a. ~ 398 a.a) partial recombinant protein with GST tag.
Sequence
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KRT16 polyclonal antibody (A01), Lot # 060118JC01 Western Blot analysis of KRT16 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — KRT16
Entrez GeneID
3868GeneBank Accession#
NM_005557Protein Accession#
NP_005548Gene Name
KRT16
Gene Alias
CK16, K16, K1CP, KRT16A, NEPPK
Gene Description
keratin 16
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus. [provided by RefSeq
Other Designations
cytokeratin 16|focal non-epidermolytic palmoplantar keratoderma|keratin, type I cytoskeletal 16
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com