Product Browser

Last updated: 2017/12/10
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KRT16 polyclonal antibody (A01)

  • Catalog # : H00003868-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KRT16.
  • Immunogen:
  • KRT16 (NP_005548, 301 a.a. ~ 398 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003868-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KRT16 polyclonal antibody (A01), Lot # 060118JC01 Western Blot analysis of KRT16 expression in 293 ( Cat # L026V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3868
  • Gene Name:
  • KRT16
  • Gene Alias:
  • CK16,K16,K1CP,KRT16A,NEPPK
  • Gene Description:
  • keratin 16
  • Gene Summary:
  • The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus. [provided by RefSeq
  • Other Designations:
  • cytokeratin 16,focal non-epidermolytic palmoplantar keratoderma,keratin, type I cytoskeletal 16
  • RSS
  • YouTube
  • Linkedin
  • Facebook