KRT13 monoclonal antibody (M05), clone 4F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KRT13.
Immunogen
KRT13 (NP_705694.1, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KRT13 expression in transfected 293T cell line by KRT13 monoclonal antibody (M05), clone 4F5.
Lane 1: KRT13 transfected lysate (Predicted MW: 49.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KRT13 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — KRT13
Entrez GeneID
3860GeneBank Accession#
NM_153490Protein Accession#
NP_705694.1Gene Name
KRT13
Gene Alias
CK13, K13, MGC161462, MGC3781
Gene Description
keratin 13
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been described. [provided by RefSeq
Other Designations
cytokeratin 13|keratin, type I cytoskeletal 13
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com