KRT7 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human KRT7 protein.
Immunogen
KRT7 (AAH02700.1, 1 a.a. ~ 469 a.a) full-length human protein.
Sequence
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KRT7 MaxPab rabbit polyclonal antibody. Western Blot analysis of KRT7 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of KRT7 expression in transfected 293T cell line (H00003855-T02) by KRT7 MaxPab polyclonal antibody.
Lane 1: KRT7 transfected lysate(51.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — KRT7
Entrez GeneID
3855GeneBank Accession#
BC002700.2Protein Accession#
AAH02700.1Gene Name
KRT7
Gene Alias
CK7, K2C7, K7, MGC129731, MGC3625, SCL
Gene Description
keratin 7
Omim ID
148059Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. [provided by RefSeq
Other Designations
cytokeratin 7|keratin, 55K type II cytoskeletal|keratin, simple epithelial type I, K7|keratin, type II cytoskeletal 7|sarcolectin|type II mesothelial keratin K7
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com