Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNPO1 polyclonal antibody (A01)

  • Catalog # : H00003842-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TNPO1.
  • Immunogen:
  • TNPO1 (NP_002261, 25 a.a. ~ 141 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003842-A01
    Western Blot detection against Immunogen (38.98 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3842
  • Gene Name:
  • TNPO1
  • Gene Alias:
  • IPO2,KPNB2,MIP,MIP1,TRN
  • Gene Description:
  • transportin 1
  • Gene Summary:
  • This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in two transcript variants encoding different proteins. [provided by RefSeq
  • Other Designations:
  • M9 region interaction protein,OTTHUMP00000126960,importin 2,importin beta 2,karyopherin (importin) beta 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook