KPNA5 monoclonal antibody (M01), clone 1D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KPNA5 monoclonal antibody (M01), clone 1D2 Western Blot analysis of KPNA5 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of KPNA5 expression in transfected 293T cell line by KPNA5 monoclonal antibody (M01), clone 1D2.
Lane 1: KPNA5 transfected lysate(60.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KPNA5 is approximately 3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of KPNA5 over-expressed 293 cell line, cotransfected with KPNA5 Validated Chimera RNAi ( Cat # H00003841-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KPNA5 monoclonal antibody (M01), clone 1D2 (Cat # H00003841-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (85.03 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant KPNA5.
Immunogen
KPNA5 (AAH47409.1, 1 a.a. ~ 539 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (94)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (85.03 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KPNA5 monoclonal antibody (M01), clone 1D2 Western Blot analysis of KPNA5 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of KPNA5 expression in transfected 293T cell line by KPNA5 monoclonal antibody (M01), clone 1D2.
Lane 1: KPNA5 transfected lysate(60.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KPNA5 is approximately 3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of KPNA5 over-expressed 293 cell line, cotransfected with KPNA5 Validated Chimera RNAi ( Cat # H00003841-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KPNA5 monoclonal antibody (M01), clone 1D2 (Cat # H00003841-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — KPNA5
Entrez GeneID
3841GeneBank Accession#
BC047409Protein Accession#
AAH47409.1Gene Name
KPNA5
Gene Alias
IPOA6, SRP6
Gene Description
karyopherin alpha 5 (importin alpha 6)
Omim ID
604545Gene Ontology
HyperlinkGene Summary
The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus. [provided by RefSeq
Other Designations
OTTHUMP00000017076|importin alpha 6|karyopherin alpha 5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com