KPNA4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KPNA4 full-length ORF ( NP_002259.1, 1 a.a. - 521 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
84.3
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KPNA4
Entrez GeneID
3840GeneBank Accession#
NM_002268.3Protein Accession#
NP_002259.1Gene Name
KPNA4
Gene Alias
IPOA3, MGC12217, MGC26703, QIP1, SRP3
Gene Description
karyopherin alpha 4 (importin alpha 3)
Omim ID
602970Gene Ontology
HyperlinkGene Summary
The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. The protein encoded by this gene shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen. [provided by RefSeq
Other Designations
importin alpha 3|importin-alpha-Q1|karyopherin alpha 4
-
Interactome
-
Publication Reference
-
mRNA location and translation rate determine protein targeting to dual destinations.
Alexander N Gasparski, Konstadinos Moissoglu, Sandeep Pallikkuth, Sezen Meydan, Nicholas R Guydosh, Stavroula Mili.
Molecular Cell 2023 Aug; 83(15):2726.
Application：Pull-Down, Human, MDA-MB-231 cells.
-
mRNA location and translation rate determine protein targeting to dual destinations.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com