Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KPNA3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003839-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KPNA3 partial ORF ( NP_002258, 422 a.a. - 521 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003839-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3839
  • Gene Name:
  • KPNA3
  • Gene Alias:
  • IPOA4,SRP1,SRP1gamma,SRP4,hSRP1
  • Gene Description:
  • karyopherin alpha 3 (importin alpha 4)
  • Gene Summary:
  • The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018426,importin alpha 4,importin alpha-3,importin-alpha-Q2,karyopherin alpha 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook