Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KPNA3 polyclonal antibody (A01)

  • Catalog # : H00003839-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KPNA3.
  • Immunogen:
  • KPNA3 (NP_002258, 422 a.a. ~ 521 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003839-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KPNA3 polyclonal antibody (A01), Lot # FAK0060120QCS1 Western Blot analysis of KPNA3 expression in IMR-32 ( Cat # L008V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3839
  • Gene Name:
  • KPNA3
  • Gene Alias:
  • IPOA4,SRP1,SRP1gamma,SRP4,hSRP1
  • Gene Description:
  • karyopherin alpha 3 (importin alpha 4)
  • Gene Summary:
  • The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018426,importin alpha 4,importin alpha-3,importin-alpha-Q2,karyopherin alpha 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook