KPNA1 monoclonal antibody (M01), clone 2A4-1B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KPNA1 monoclonal antibody (M01), clone 2A4-1B5 Western Blot analysis of KPNA1 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of KPNA1 expression in transfected 293T cell line by KPNA1 monoclonal antibody (M01), clone 2A4-1B5.
Lane 1: KPNA1 transfected lysate(60.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KPNA1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KPNA1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (84.92 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant KPNA1.
Immunogen
KPNA1 (AAH02374.1, 1 a.a. ~ 538 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (84.92 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KPNA1 monoclonal antibody (M01), clone 2A4-1B5 Western Blot analysis of KPNA1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of KPNA1 expression in transfected 293T cell line by KPNA1 monoclonal antibody (M01), clone 2A4-1B5.
Lane 1: KPNA1 transfected lysate(60.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KPNA1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KPNA1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — KPNA1
Entrez GeneID
3836GeneBank Accession#
BC002374Protein Accession#
AAH02374.1Gene Name
KPNA1
Gene Alias
IPOA5, NPI-1, RCH2, SRP1
Gene Description
karyopherin alpha 1 (importin alpha 5)
Omim ID
600686Gene Ontology
HyperlinkGene Summary
Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Two transcript variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq
Other Designations
importin alpha 5|importin-alpha-S1|karyopherin alpha 1|nucleoprotein interactor 1|recombination activating gene cohort 2
-
Interactome
-
Publication Reference
-
Identification and characterization of a nuclear localization signal of TRIM28 that overlaps with the HP1 box.
Moriyama T, Sangel P, Yamaguchi H, Obuse C, Miyamoto Y, Oka M, Yoneda Y.
Biochemical and Biophysical Research Communications 2015 Jul; 462(3):201.
Application：WB-Tr, Human, HeLa cells.
-
Targeted disruption of one of the importin α family members leads to female functional incompetence in delivery.
Moriyama T, Nagai M, Oka M, Ikawa M, Okabe M, Yoneda Y.
FEBS J 2011 Mar; 278:1561.
Application：WB-Ti, Mouse, Uterus, Brain, Thymus, Lung, Heart, Kidney, Liver, Spleen, Testis, Ovary.
-
Nuclear import impairment causes cytoplasmic trans-activation response DNA-binding protein accumulation and is associated with frontotemporal lobar degeneration.
Nishimura AL, Zupunski V, Troakes C, Kathe C, Fratta P, Howell M, Gallo JM, Hortobágyi T, Shaw CE, Rogelj B.
Brain 2010 Jun; 133(Pt 6):1763.
Application：WB, Human, Brain, spinal cord.
-
Identification and characterization of a nuclear localization signal of TRIM28 that overlaps with the HP1 box.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com