Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00003836-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human KPNA1 protein.
  • Immunogen:
  • KPNA1 (NP_002255.2, 1 a.a. ~ 538 a.a) full-length human protein.
  • Sequence:
  • MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • KPNA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KPNA1 expression in human placenta.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • KPNA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KPNA1 expression in mouse intestine.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of KPNA1 expression in transfected 293T cell line by KPNA1 MaxPab rabbit polyclonal antibody.

    Lane 1: KPNA1 transfected lysate(60.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3836
  • Gene Name:
  • KPNA1
  • Gene Alias:
  • IPOA5,NPI-1,RCH2,SRP1
  • Gene Description:
  • karyopherin alpha 1 (importin alpha 5)
  • Gene Summary:
  • Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Two transcript variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • importin alpha 5,importin-alpha-S1,karyopherin alpha 1,nucleoprotein interactor 1,recombination activating gene cohort 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook