KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
KPNA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KPNA1 expression in human placenta.
Western Blot (Tissue lysate)
KPNA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KPNA1 expression in mouse intestine.
Western Blot (Transfected lysate)
Western Blot analysis of KPNA1 expression in transfected 293T cell line by KPNA1 MaxPab rabbit polyclonal antibody.
Lane 1: KPNA1 transfected lysate(60.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human KPNA1 protein.
Immunogen
KPNA1 (NP_002255.2, 1 a.a. ~ 538 a.a) full-length human protein.
Sequence
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
KPNA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KPNA1 expression in human placenta.Western Blot (Tissue lysate)
KPNA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KPNA1 expression in mouse intestine.Western Blot (Transfected lysate)
Western Blot analysis of KPNA1 expression in transfected 293T cell line by KPNA1 MaxPab rabbit polyclonal antibody.
Lane 1: KPNA1 transfected lysate(60.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — KPNA1
Entrez GeneID
3836GeneBank Accession#
NM_002264Protein Accession#
NP_002255.2Gene Name
KPNA1
Gene Alias
IPOA5, NPI-1, RCH2, SRP1
Gene Description
karyopherin alpha 1 (importin alpha 5)
Omim ID
600686Gene Ontology
HyperlinkGene Summary
Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Two transcript variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq
Other Designations
importin alpha 5|importin-alpha-S1|karyopherin alpha 1|nucleoprotein interactor 1|recombination activating gene cohort 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com