KPNA1 polyclonal antibody (A02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KPNA1 polyclonal antibody (A02), Lot # 061025JCS1 Western Blot analysis of KPNA1 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
KPNA1 polyclonal antibody (A02), Lot # 061025JCS1. Western Blot analysis of KPNA1 expression in Raw 264.7.
Western Blot (Cell lysate)
KPNA1 polyclonal antibody (A02), Lot # 061025JCS1. Western Blot analysis of KPNA1 expression in PC-12.
Western Blot detection against Immunogen (85.29 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant KPNA1.
Immunogen
KPNA1 (AAH02374.1, 1 a.a. ~ 538 a.a) full-length recombinant protein with GST tag.
Sequence
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (85.29 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KPNA1 polyclonal antibody (A02), Lot # 061025JCS1 Western Blot analysis of KPNA1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
KPNA1 polyclonal antibody (A02), Lot # 061025JCS1. Western Blot analysis of KPNA1 expression in Raw 264.7.Western Blot (Cell lysate)
KPNA1 polyclonal antibody (A02), Lot # 061025JCS1. Western Blot analysis of KPNA1 expression in PC-12.Western Blot (Recombinant protein)
ELISA
-
Gene Info — KPNA1
Entrez GeneID
3836GeneBank Accession#
BC002374Protein Accession#
AAH02374.1Gene Name
KPNA1
Gene Alias
IPOA5, NPI-1, RCH2, SRP1
Gene Description
karyopherin alpha 1 (importin alpha 5)
Omim ID
600686Gene Ontology
HyperlinkGene Summary
Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Two transcript variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq
Other Designations
importin alpha 5|importin-alpha-S1|karyopherin alpha 1|nucleoprotein interactor 1|recombination activating gene cohort 2
-
Interactome
-
Publication Reference
-
Nuclear localization of endogenous RGK proteins and modulation of cell shape remodeling by regulated nuclear transport.
Mahalakshmi RN, Ng MY, Guo K, Qi Z, Hunziker W, Beguin P.
Traffic 2007 Jul; 8(9):1164.
Application：WB, Human, HeLa cells.
-
Nuclear localization of endogenous RGK proteins and modulation of cell shape remodeling by regulated nuclear transport.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com