KIFC1 monoclonal antibody (M01), clone 2B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KIFC1.
Immunogen
KIFC1 (AAH00712, 53 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (62); Rat (59)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KIFC1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KIFC1 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to KIFC1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — KIFC1
Entrez GeneID
3833GeneBank Accession#
BC000712Protein Accession#
AAH00712Gene Name
KIFC1
Gene Alias
HSET, KNSL2, MGC1202, MGC149736, MGC149737
Gene Description
kinesin family member C1
Omim ID
603763Gene Ontology
HyperlinkOther Designations
OTTHUMP00000029296|kinesin-like 2|kinesin-like protein 2|kinesin-related protein HSET
-
Interactome
-
Disease
-
Publication Reference
-
Expression of kinesin family member C1 in pancreatic ductal adenocarcinoma affects tumor progression and stemness.
Akira Ishikawa, Hiroki Fujii, Takafumi Fukui, Aya Kido, Narutaka Katsuya, Kazuhiro Sentani, Kazuya Kuraoka, Sho Tazuma, Takeshi Sudo, Masahiro Serikawa, Shiro Oka, Naohide Oue.
Pathology, Research and Practice 2022 Dec; 241:154277.
Application:IHC, Human, Human pancrease, PANC-1, PK-1 cells.
-
KIFC1 Inhibitor CW069 Induces Apoptosis and Reverses Resistance to Docetaxel in Prostate Cancer.
Sekino Y, Oue N, Koike Y, Shigematsu Y, Sakamoto N, Sentani K, Teishima J, Shiota M, Matsubara A, Yasui W.
Journal of Clinical Medicine 2019 Feb; 8(2):E225.
Application:WB, Human, DU145, C4-2 cells.
-
Induction of KIFC1 expression in gastric cancer spheroids.
Oue N, Mukai S, Imai T, Pham TTB, Oshima T, Sentani K, Sakamoto N, Yoshida K, Yasui W.
Oncology Reports 2016 Apr; 36(1):349.
Application:IHC, WB-Tr, Human, Human gastric cancer, Human non-neoplastic gastric mucosa, MKN-45 cells.
-
The Presence of Kinesin Superfamily Motor Proteins KIFC1 and KIF17 in Normal and Pathological Human Placenta.
Sati L, Seval-Celik Y, Unek G, Korgun ET, Demir R.
Placenta 2009 Oct; 30(10):848.
Application:IHC-P, WB-Ti, Human, Human placenta.
-
Expression of kinesin family member C1 in pancreatic ductal adenocarcinoma affects tumor progression and stemness.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com