KLRC3 monoclonal antibody (M01), clone 3D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLRC3.
Immunogen
KLRC3 (NP_002252, 132 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRLVLNS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KLRC3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — KLRC3
Entrez GeneID
3823GeneBank Accession#
NM_002261Protein Accession#
NP_002252Gene Name
KLRC3
Gene Alias
NKG2-E, NKG2E
Gene Description
killer cell lectin-like receptor subfamily C, member 3
Omim ID
602892Gene Ontology
HyperlinkGene Summary
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
Human NKG2E Is Expressed and Forms an Intracytoplasmic Complex with CD94 and DAP12.
Orbelyan GA, Tang F, Sally B, Solus J, Meresse B, Ciszewski C, Grenier JC, Barreiro LB, Lanier LL, Jabri B.
The Journal of Immunology 2014 Jul; 193(2):610.
Application:Flow Cyt, Human, Mouse, Ba/F3, 293T cells.
-
Glycosylation-related gene expression is linked to differentiation status in glioblastomas undifferentiated cells.
Cheray M, Petit D, Forestier L, Karayan-Tapon L, Maftah A, Jauberteau MO, Battu S, Gallet FP, Lalloue F.
Cancer Letters 2011 Dec; 312(1):24.
Application:WB-Ce, Human, U87 MG, U251 cells.
-
Human NKG2E Is Expressed and Forms an Intracytoplasmic Complex with CD94 and DAP12.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com