KLRC1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant KLRC1.
Immunogen
KLRC1 (NP_998823, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag.
Sequence
MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.81 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KLRC1 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of KLRC1 expression in SJCRH30 ( Cat # L027V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — KLRC1
Entrez GeneID
3821GeneBank Accession#
NM_213658Protein Accession#
NP_998823Gene Name
KLRC1
Gene Alias
CD159A, MGC13374, MGC59791, NKG2, NKG2A
Gene Description
killer cell lectin-like receptor subfamily C, member 1
Omim ID
161555Gene Ontology
HyperlinkGene Summary
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq
Other Designations
C-lectin type II protein|NK cell receptor A|NKG2-1/B activating NK receptor|NKG2-A/B type II integral membrane protein|natural killer cell lectin|natural killer group protein 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com