KLRB1 monoclonal antibody (M01J), clone 2F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant KLRB1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
KLRB1 (NP_002249, 126 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (50); Rat (51)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KLRB1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — KLRB1
Entrez GeneID
3820GeneBank Accession#
NM_002258Protein Accession#
NP_002249Gene Name
KLRB1
Gene Alias
CD161, CLEC5B, MGC138614, NKR, NKR-P1, NKR-P1A, NKRP1A, hNKR-P1A
Gene Description
killer cell lectin-like receptor subfamily B, member 1
Omim ID
602890Gene Ontology
HyperlinkGene Summary
Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein is classified as a type II membrane protein because it has an external C terminus. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com