Product Browser

Last updated: 2017/9/24
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KLK2 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00003817-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human KLK2 protein.
  • Immunogen:
  • KLK2 (NP_001002231.1, 1 a.a. ~ 223 a.a) full-length human protein.
  • Sequence:
  • MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGVSHPYSQHLEGKG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of KLK2 expression in transfected 293T cell line (H00003817-T02) by KLK2 MaxPab polyclonal antibody.

    Lane 1: KLK2 transfected lysate(24.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of KLK2 transfected lysate using anti-KLK2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with KLK2 purified MaxPab mouse polyclonal antibody (B01P) (H00003817-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3817
  • Gene Name:
  • KLK2
  • Gene Alias:
  • KLK2A2,MGC12201,hK2
  • Gene Description:
  • kallikrein-related peptidase 2
  • Other Designations:
  • glandular kallikrein 2,kallikrein 2, prostatic
  • RSS
  • YouTube
  • Linkedin
  • Facebook