KLK1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
KLK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KLK1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of KLK1 expression in transfected 293T cell line (H00003816-T01) by KLK1 MaxPab polyclonal antibody.
Lane 1: KLK1 transfected lysate(28.90 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human KLK1 protein.
Immunogen
KLK1 (NP_002248.1, 1 a.a. ~ 262 a.a) full-length human protein.
Sequence
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
KLK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KLK1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of KLK1 expression in transfected 293T cell line (H00003816-T01) by KLK1 MaxPab polyclonal antibody.
Lane 1: KLK1 transfected lysate(28.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — KLK1
Entrez GeneID
3816GeneBank Accession#
NM_002257.2Protein Accession#
NP_002248.1Gene Name
KLK1
Gene Alias
KLKR, Klk6, hK1
Gene Description
kallikrein 1
Omim ID
147910Gene Ontology
HyperlinkGene Summary
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. This protein is functionally conserved in its capacity to release the vasoactive peptide, Lys-bradykinin, from low molecular weight kininogen. [provided by RefSeq
Other Designations
glandular kallikrein 1|kallikrein 1, renal/pancreas/salivary|kallikrein serine protease 1|tissue kallikrein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com