Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNN4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003783-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNN4 partial ORF ( AAH15337, 328 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • HTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003783-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3783
  • Gene Name:
  • KCNN4
  • Gene Alias:
  • IK1,IKCA1,KCA4,KCa3.1,SK4,hIKCa1,hKCa4,hSK4
  • Gene Description:
  • potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4
  • Gene Summary:
  • The protein encoded by this gene is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. The encoded protein may be part of the predominant calcium-activated potassium channel in T-lymphocytes. This gene is similar to other KCNN family potassium channel genes, but it differs enough to possibly be considered as part of a new subfamily. [provided by RefSeq
  • Other Designations:
  • intermediate conductance calcium-activated potassium channel protein 1,putative erythrocyte intermediate conductance calcium-activated potassium Gardos channel
  • RSS
  • YouTube
  • Linkedin
  • Facebook