Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNMB1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003779-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNMB1 partial ORF ( AAH25707, 39 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQVLNWRDGDTSLYPCQVCEPVPNCPCPRG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.75
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003779-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3779
  • Gene Name:
  • KCNMB1
  • Gene Alias:
  • K(VCA)beta,SLO-BETA,hslo-beta
  • Gene Description:
  • potassium large conductance calcium-activated channel, subfamily M, beta member 1
  • Gene Summary:
  • MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the product of this gene, the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. [provided by RefSeq
  • Other Designations:
  • BK channel beta subunit,Maxi K channel beta subunit,large conductance Ca2+-activated K+ channel beta 1 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook