Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNJ15 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003772-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNJ15 partial ORF ( NP_002234, 290 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003772-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3772
  • Gene Name:
  • KCNJ15
  • Gene Alias:
  • IRKK,KIR1.3,KIR4.2,MGC13584
  • Gene Description:
  • potassium inwardly-rectifying channel, subfamily J, member 15
  • Gene Summary:
  • Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • ATP-sensitive inward rectifier potassium channel 15,OTTHUMP00000115739,OTTHUMP00000115740,inward rectifier K+ channel KIR4.2,potassium inwardly-rectifying channel J15
  • RSS
  • YouTube
  • Linkedin
  • Facebook