KCNJ15 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNJ15 partial ORF ( NP_002234, 290 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNJ15
Entrez GeneID
3772GeneBank Accession#
NM_002243Protein Accession#
NP_002234Gene Name
KCNJ15
Gene Alias
IRKK, KIR1.3, KIR4.2, MGC13584
Gene Description
potassium inwardly-rectifying channel, subfamily J, member 15
Omim ID
602106Gene Ontology
HyperlinkGene Summary
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
ATP-sensitive inward rectifier potassium channel 15|OTTHUMP00000115739|OTTHUMP00000115740|inward rectifier K+ channel KIR4.2|potassium inwardly-rectifying channel J15
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com