KCNJ15 monoclonal antibody (M01), clone 1B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KCNJ15.
Immunogen
KCNJ15 (NP_002234, 290 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KCNJ15 expression in transfected 293T cell line by KCNJ15 monoclonal antibody (M01), clone 1B2.
Lane 1: KCNJ15 transfected lysate(42.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNJ15 is 3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of KCNJ15 over-expressed 293 cell line, cotransfected with KCNJ15 Validated Chimera RNAi ( Cat # H00003772-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNJ15 monoclonal antibody (M01), clone 1B2 (Cat # H00003772-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — KCNJ15
Entrez GeneID
3772GeneBank Accession#
NM_002243Protein Accession#
NP_002234Gene Name
KCNJ15
Gene Alias
IRKK, KIR1.3, KIR4.2, MGC13584
Gene Description
potassium inwardly-rectifying channel, subfamily J, member 15
Omim ID
602106Gene Ontology
HyperlinkGene Summary
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
ATP-sensitive inward rectifier potassium channel 15|OTTHUMP00000115739|OTTHUMP00000115740|inward rectifier K+ channel KIR4.2|potassium inwardly-rectifying channel J15
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com