Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNJ10 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003766-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNJ10 partial ORF ( NP_002232, 276 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.18
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003766-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3766
  • Gene Name:
  • KCNJ10
  • Gene Alias:
  • BIRK-10,KCNJ13-PEN,KIR1.2,KIR4.1
  • Gene Description:
  • potassium inwardly-rectifying channel, subfamily J, member 10
  • Gene Summary:
  • This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. [provided by RefSeq
  • Other Designations:
  • ATP-sensitive inward rectifier potassium channel 10,OTTHUMP00000025748,glial ATP-dependent inwardly rectifying potassium channel KIR4.1,inward rectifier K+ channel KIR1.2,inwardly-rectifying potassium channel Kir1.2
  • RSS
  • YouTube
  • Linkedin
  • Facebook