KCNJ10 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNJ10 partial ORF ( NP_002232, 276 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.18
Interspecies Antigen Sequence
Mouse (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNJ10
Entrez GeneID
3766GeneBank Accession#
NM_002241Protein Accession#
NP_002232Gene Name
KCNJ10
Gene Alias
BIRK-10, KCNJ13-PEN, KIR1.2, KIR4.1
Gene Description
potassium inwardly-rectifying channel, subfamily J, member 10
Omim ID
602208Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. [provided by RefSeq
Other Designations
ATP-sensitive inward rectifier potassium channel 10|OTTHUMP00000025748|glial ATP-dependent inwardly rectifying potassium channel KIR4.1|inward rectifier K+ channel KIR1.2|inwardly-rectifying potassium channel Kir1.2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com