KCNJ10 monoclonal antibody (M01), clone 1C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KCNJ10.
Immunogen
KCNJ10 (NP_002232, 276 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNJ10 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — KCNJ10
Entrez GeneID
3766GeneBank Accession#
NM_002241Protein Accession#
NP_002232Gene Name
KCNJ10
Gene Alias
BIRK-10, KCNJ13-PEN, KIR1.2, KIR4.1
Gene Description
potassium inwardly-rectifying channel, subfamily J, member 10
Omim ID
602208Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. [provided by RefSeq
Other Designations
ATP-sensitive inward rectifier potassium channel 10|OTTHUMP00000025748|glial ATP-dependent inwardly rectifying potassium channel KIR4.1|inward rectifier K+ channel KIR1.2|inwardly-rectifying potassium channel Kir1.2
-
Interactome
-
Disease
-
Publication Reference
-
Free radical stress-mediated loss of Kcnj10 protein expression in stria vascularis contributes to deafness in Pendred syndrome mouse model.
Singh R, Wangemann P.
American Journal of Physiology. Renal Physiology 2007 Oct; 294(1):F139.
Application:IP, WB, Mouse, Mouse stria vascularis.
-
Free radical stress-mediated loss of Kcnj10 protein expression in stria vascularis contributes to deafness in Pendred syndrome mouse model.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com