KCNH2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNH2 partial ORF ( AAH01914, 684 a.a. - 773 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LGMGWGAGTGLEMPSAASRGASLLNMQSLGLWTWDCLQGHWAPLIHLNSGPPSGAMERSPTWGEAAELWGSHILLPFRIRHKQTLFASLK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Interspecies Antigen Sequence
Mouse (36); Rat (36)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNH2
Entrez GeneID
3757GeneBank Accession#
BC001914Protein Accession#
AAH01914Gene Name
KCNH2
Gene Alias
ERG1, HERG, HERG1, Kv11.1, LQT2, SQT1
Gene Description
potassium voltage-gated channel, subfamily H (eag-related), member 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
cause of Long QT Syndrome Type 2|ether-a-go-go-related potassium channel protein|human eag-related|potassium channel HERG|potassium channel HERG1|potassium voltage-gated channel, subfamily H, member 2|voltage-gated potassium channel|voltage-gated potassiu
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com