Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNH2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003757-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNH2 partial ORF ( AAH01914, 684 a.a. - 773 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LGMGWGAGTGLEMPSAASRGASLLNMQSLGLWTWDCLQGHWAPLIHLNSGPPSGAMERSPTWGEAAELWGSHILLPFRIRHKQTLFASLK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003757-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3757
  • Gene Name:
  • KCNH2
  • Gene Alias:
  • ERG1,HERG,HERG1,Kv11.1,LQT2,SQT1
  • Gene Description:
  • potassium voltage-gated channel, subfamily H (eag-related), member 2
  • Gene Summary:
  • This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • cause of Long QT Syndrome Type 2,ether-a-go-go-related potassium channel protein,human eag-related,potassium channel HERG,potassium channel HERG1,potassium voltage-gated channel, subfamily H, member 2,voltage-gated potassium channel,voltage-gated potassiu
  • RSS
  • YouTube
  • Linkedin
  • Facebook