Product Browser

Last updated: 2017/6/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNH1 polyclonal antibody (A01)

  • Catalog # : H00003756-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KCNH1.
  • Immunogen:
  • KCNH1 (NP_758872, 890 a.a. ~ 988 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPESERDIFGA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003756-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KCNH1 polyclonal antibody (A01), Lot # 061110JCS1 Western Blot analysis of KCNH1 expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3756
  • Gene Name:
  • KCNH1
  • Gene Alias:
  • EAG,EAG1,Kv10.1,MGC142269,h-eag
  • Gene Description:
  • potassium voltage-gated channel, subfamily H (eag-related), member 1
  • Gene Summary:
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000034451,OTTHUMP00000034569,ether-a-go-go potassium channel 1,ether-a-go-go, Drosophila, homolog of,potassium channel, voltage-gated, subfamily H, member 1,potassium voltage-gated channel, subfamily H, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook