KCNE1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNE1 partial ORF ( NP_000210, 67 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.67
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNE1
Entrez GeneID
3753GeneBank Accession#
NM_000219Protein Accession#
NP_000210Gene Name
KCNE1
Gene Alias
FLJ18426, FLJ38123, FLJ94103, ISK, JLNS, JLNS2, LQT2/5, LQT5, MGC33114, MinK
Gene Description
potassium voltage-gated channel, Isk-related family, member 1
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
IKs producing slow voltage-gated potassium channel subunit beta Mink|OTTHUMP00000108623|OTTHUMP00000108625|OTTHUMP00000108626|cardiac delayed rectifier potassium channel protein|delayed rectifier potassium channel subunit IsK|minimal potassium channel|pot
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com