Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNC3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003748-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNC3 partial ORF ( NP_004968, 671 a.a. - 757 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.31
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003748-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3748
  • Gene Name:
  • KCNC3
  • Gene Alias:
  • KSHIIID,KV3.3,SCA13
  • Gene Description:
  • potassium voltage-gated channel, Shaw-related subfamily, member 3
  • Gene Summary:
  • The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. [provided by RefSeq
  • Other Designations:
  • Shaw-related voltage-gated potassium channel protein 3,voltage-gated potassium channel protein KV3.3
  • RSS
  • YouTube
  • Linkedin
  • Facebook