Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNA4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003739-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNA4 partial ORF ( NP_002224, 562 a.a. - 652 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.75
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003739-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3739
  • Gene Name:
  • KCNA4
  • Gene Alias:
  • HBK4,HK1,HPCN2,HUKII,KCNA4L,KCNA8,KV1.4,PCN2
  • Gene Description:
  • potassium voltage-gated channel, shaker-related subfamily, member 4
  • Gene Summary:
  • Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influnce the duration of cardiac action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1. [provided by RefSeq
  • Other Designations:
  • cardiac potassium channel,fetal skeletal muscle potassium channel,potassium channel 2,potassium voltage-gated channel, shaker-related subfamily, member 4-like,rapidly inactivating potassium channel,shaker-related potassium channel Kv1.4,type A potassium c
  • RSS
  • YouTube
  • Linkedin
  • Facebook