Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KAL1 polyclonal antibody (A01)

  • Catalog # : H00003730-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KAL1.
  • Immunogen:
  • KAL1 (NP_000207, 548 a.a. ~ 657 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRTPELPP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003730-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KAL1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1 Western Blot analysis of KAL1 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3730
  • Gene Name:
  • KAL1
  • Gene Alias:
  • ADMLX,HHA,KAL,KALIG-1,KMS
  • Gene Description:
  • Kallmann syndrome 1 sequence
  • Gene Summary:
  • Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity. [provided by RefSeq
  • Other Designations:
  • Kallmann syndrome 1 protein,Kallmann syndrome interval gene 1,Kallmann syndrome-1 sequence (anosmin-1),OTTHUMP00000022873,adhesion molecule-like X-linked,anosmin-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook