Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

JUN MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00003725-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human JUN protein.
  • Immunogen:
  • JUN (AAH68522.1, 1 a.a. ~ 331 a.a) full-length human protein.
  • Sequence:
  • MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of JUN expression in transfected 293T cell line (H00003725-T01) by JUN MaxPab polyclonal antibody.

    Lane 1: JUN transfected lysate(36.41 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3725
  • Gene Name:
  • JUN
  • Gene Alias:
  • AP-1,AP1,c-Jun
  • Gene Description:
  • jun oncogene
  • Gene Summary:
  • This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq
  • Other Designations:
  • Jun activation domain binding protein,OTTHUMP00000010036,activator protein 1,enhancer-binding protein AP1,v-jun avian sarcoma virus 17 oncogene homolog,v-jun sarcoma virus 17 oncogene homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook