Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITPA (Human) Recombinant Protein (Q01)

  • Catalog # : H00003704-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ITPA partial ORF ( NP_258412.1, 89 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.29
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003704-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3704
  • Gene Name:
  • ITPA
  • Gene Alias:
  • C20orf37,HLC14-06-P,ITPase,dJ794I6.3
  • Gene Description:
  • inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
  • Gene Summary:
  • The protein encoded by this gene hydrolyzes inosine triphosphate and deoxyinosine triphosphate to the monophosphate nucleotide and diphosphate. The encoded protein, which is a member of the HAM1 NTPase protein family, is found in the cytoplasm and acts as a homodimer. Defects in the encoded protein can result in inosine triphosphate pyrophosphorylase deficiency. Two transcript variants encoding two different isoforms have been found for this gene. Also, at least two other transcript variants have been identified which are probably regulatory rather than protein-coding. [provided by RefSeq
  • Other Designations:
  • My049 protein,OTTHUMP00000030094,inosine triphosphatase,inosine triphosphatase-A,inosine triphosphate pyrophosphatase,inosine triphosphate pyrophosphohydrolase,nucleoside triphosphate diphosphatase,putative oncogene protein HLC14-06-P
  • RSS
  • YouTube
  • Linkedin
  • Facebook