ITGB8 monoclonal antibody (M01), clone 2B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ITGB8 expression in transfected 293T cell line by ITGB8 monoclonal antibody (M01), clone 2B4.
Lane 1: ITGB8 transfected lysate(85.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ITGB8 transfected lysate using anti-ITGB8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ITGB8 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITGB8 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.06 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ITGB8.
Immunogen
ITGB8 (NP_002205, 392 a.a. ~ 503 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.06 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ITGB8 expression in transfected 293T cell line by ITGB8 monoclonal antibody (M01), clone 2B4.
Lane 1: ITGB8 transfected lysate(85.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of ITGB8 transfected lysate using anti-ITGB8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ITGB8 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITGB8 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ITGB8
Entrez GeneID
3696GeneBank Accession#
NM_002214Protein Accession#
NP_002205Gene Name
ITGB8
Gene Alias
-
Gene Description
integrin, beta 8
Omim ID
604160Gene Ontology
HyperlinkGene Summary
This gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
β5 integrin is the major contributor to the αVintegrin-mediated blockade of HIV-1 replication.
Ballana E, Pauls E, Clotet B, Perron-Sierra F, Tucker GC, Este JA.
Journal of Immunology 2011 Jan; 186(1):464.
Application：Flow Cyt, Func, Human, Primary monocyte-derived macrophages.
-
β5 integrin is the major contributor to the αVintegrin-mediated blockade of HIV-1 replication.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com