ITGB5 monoclonal antibody (M01), clone 2C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ITGB5 monoclonal antibody (M01), clone 2C4 Western Blot analysis of ITGB5 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ITGB5 expression in transfected 293T cell line by ITGB5 monoclonal antibody (M01), clone 2C4.
Lane 1: ITGB5 transfected lysate(88.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITGB5 is approximately 0.3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of ITGB5 over-expressed 293 cell line, cotransfected with ITGB5 Validated Chimera RNAi ( Cat # H00003693-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ITGB5 monoclonal antibody (M01), clone 2C4 (Cat # H00003693-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.3 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ITGB5.
Immunogen
ITGB5 (NP_002204, 421 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (83)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ITGB5 monoclonal antibody (M01), clone 2C4 Western Blot analysis of ITGB5 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ITGB5 expression in transfected 293T cell line by ITGB5 monoclonal antibody (M01), clone 2C4.
Lane 1: ITGB5 transfected lysate(88.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITGB5 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ITGB5 over-expressed 293 cell line, cotransfected with ITGB5 Validated Chimera RNAi ( Cat # H00003693-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ITGB5 monoclonal antibody (M01), clone 2C4 (Cat # H00003693-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ITGB5
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
LPPR4 promotes peritoneal metastasis via Sp1/integrin α/FAK signaling in gastric cancer.
Zang D, Zhang C, Li C, Fan Y, Li Z, Hou K, Che X, Liu Y, Qu X.
American Journal of Cancer Research 2020 Mar; 10(3):1026.
Application：WB-Tr, Human, HGC27, MGC803 cells.
-
β5 integrin is the major contributor to the αVintegrin-mediated blockade of HIV-1 replication.
Ballana E, Pauls E, Clotet B, Perron-Sierra F, Tucker GC, Este JA.
Journal of Immunology 2011 Jan; 186(1):464.
Application：Flow Cyt, IF, Human, Primary monocyte-derived macrophages.
-
LPPR4 promotes peritoneal metastasis via Sp1/integrin α/FAK signaling in gastric cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com