Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF6 (Human) Recombinant Protein (P01)

  • Catalog # : H00003692-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EIF6 full-length ORF ( NP_002203.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003692-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3692
  • Gene Name:
  • EIF6
  • Gene Alias:
  • 2,CAB,EIF3A,ITGB4BP,b,b(2)gcn,gcn,p27BBP
  • Gene Description:
  • eukaryotic translation initiation factor 6
  • Gene Summary:
  • Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • B4 integrin interactor,OTTHUMP00000030734,OTTHUMP00000061360,OTTHUMP00000061361,eukaryotic translation initiation factor 3A,integrin beta 4 binding protein,p27 beta-4 integrin-binding protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook