ITGB4BP polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ITGB4BP polyclonal antibody (A01), Lot # 051122JC01 Western Blot analysis of ITGB4BP expression in HL-60 ( Cat # L014V1 ).
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ITGB4BP.
Immunogen
ITGB4BP (NP_002203, 146 a.a. ~ 245 a.a) partial recombinant protein with GST tag.
Sequence
VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ITGB4BP polyclonal antibody (A01), Lot # 051122JC01 Western Blot analysis of ITGB4BP expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — EIF6
Entrez GeneID
3692GeneBank Accession#
NM_002212Protein Accession#
NP_002203Gene Name
EIF6
Gene Alias
2, CAB, EIF3A, ITGB4BP, b, b(2)gcn, gcn, p27BBP
Gene Description
eukaryotic translation initiation factor 6
Omim ID
602912Gene Ontology
HyperlinkGene Summary
Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
B4 integrin interactor|OTTHUMP00000030734|OTTHUMP00000061360|OTTHUMP00000061361|eukaryotic translation initiation factor 3A|integrin beta 4 binding protein|p27 beta-4 integrin-binding protein
-
Interactome
-
Disease
-
Publication Reference
-
Process of Hypertrophic Scar Formation: Expression of Eukaryotic Initiation Factor 6.
Yang QQ, Yang SS, Tan JL, Luo GX, He WF, Wu J.
Chinese Medical Journal 2015 Oct; 128(20):2787.
Application：IHC-P, WB-Ti, Human, Hypertrophic scar, Skin.
-
Identification of ITGB4BP as a new interaction protein of P311.
Peng X, Yuan S, Tan J, Ma B, Bian X, Xu C, He W, Cao H, Huang Z, Cui Y, Gan C, Wang X, Zhou J, Hu J, Yang S, Luo G, Wu J.
Life sciences 2012 Apr; 90(15-16):585.
Application：IHC, Human, Lung, Pulmonary adenocarcinoma.
-
Process of Hypertrophic Scar Formation: Expression of Eukaryotic Initiation Factor 6.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com