Product Browser

Last updated: 2016/12/11
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITGAX polyclonal antibody (A01)

  • Catalog # : H00003687-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ITGAX.
  • Immunogen:
  • ITGAX (NP_000878, 114 a.a. ~ 223 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003687-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3687
  • Gene Name:
  • ITGAX
  • Gene Alias:
  • CD11C,SLEB6
  • Gene Description:
  • integrin, alpha X (complement component 3 receptor 4 subunit)
  • Gene Summary:
  • This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as inactivated-C3b (iC3b) receptor 4 (CR4). The alpha X beta 2 complex seems to overlap the properties of the alpha M beta 2 integrin in the adherence of neutrophils and monocytes to stimulated endothelium cells, and in the phagocytosis of complement coated particles. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000163299,integrin alpha X,integrin, alpha X (antigen CD11C (p150), alpha polypeptide),leu M5, alpha subunit,leukocyte surface antigen p150,95, alpha subunit,myeloid membrane antigen, alpha subunit,p150 95 integrin alpha chain
  • RSS
  • YouTube
  • Linkedin
  • Facebook