ITGAE (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ITGAE partial ORF ( NP_002199, 57 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.39
Interspecies Antigen Sequence
Mouse (56); Rat (57)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ITGAE
Entrez GeneID
3682GeneBank Accession#
NM_002208Protein Accession#
NP_002199Gene Name
ITGAE
Gene Alias
CD103, HUMINAE, MGC141996
Gene Description
integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide)
Omim ID
604682Gene Ontology
HyperlinkGene Summary
Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. [provided by RefSeq
Other Designations
HML-1 antigen|antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide|integrin alpha-IEL|integrin, alpha E
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com