ITGA9 monoclonal antibody (M01), clone 3E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ITGA9 monoclonal antibody (M01), clone 3E4. Western Blot analysis of ITGA9 expression in HepG2.
Western Blot detection against Immunogen (36.96 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ITGA9.
Immunogen
ITGA9 (NP_002198, 785 a.a. ~ 886 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ITGA9 monoclonal antibody (M01), clone 3E4. Western Blot analysis of ITGA9 expression in HepG2.Western Blot (Recombinant protein)
ELISA
-
Gene Info — ITGA9
Entrez GeneID
3680GeneBank Accession#
NM_002207Protein Accession#
NP_002198Gene Name
ITGA9
Gene Alias
ALPHA-RLC, ITGA4L, RLC
Gene Description
integrin, alpha 9
Omim ID
603963Gene Ontology
HyperlinkGene Summary
This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain, forms an integrin that is a receptor for VCAM1, cytotactin and osteopontin. Expression of this gene has been found to be upregulated in small cell lung cancers. [provided by RefSeq
Other Designations
integrin, alpha 4-like
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Integrin alpha9 emerges as a key therapeutic target to reduce metastasis in rhabdomyosarcoma and neuroblastoma.
Natalia Navarro, Carla Molist, Júlia Sansa-Girona, Patricia Zarzosa, Gabriel Gallo-Oller, Guillem Pons, Ainara Magdaleno, Gabriela Guillén, Raquel Hladun, Marta Garrido, Miguel F Segura , Lourdes Hontecillas-Prieto, Enrique de Álava, Berta Ponsati, Jimena Fernández-Carneado, Ana Almazán-Moga, Mariona Vallès-Miret, Josep Farrera-Sinfreu, Josep Sánchez de Toledo, Lucas Moreno, Soledad Gallego, Josep Roma.
Cellular and Molecular Life Sciences : CMLS 2022 Oct; 79(11):546.
Application：WB-Ce, WB-Tr, Human, BE(2)-C, CHLA90, MDA-MB-231, MDA-MB-468, RD, RH30 cells.
-
miRNA-7 and miRNA-324-5p regulate alpha9-Integrin expression and exert anti-oncogenic effects in rhabdomyosarcoma.
Molist C, Navarro N, Giralt I, Zarzosa P, Gallo-Oller G, Pons G, Magdaleno A, Moreno L, Guillén G, Hladun R, Garrido M, Soriano A, Segura MF, Sánchez de Toledo J, Gallego S, Roma J.
Cancer Letters 2020 May; 477:49.
Application：WB-Ce, WB-Tr, Human, CW9019, HT882, RD, RH30, Ruch2 cells.
-
Notch-mediated induction of N-cadherin and α9-integrin confers higher invasive phenotype on rhabdomyosarcoma cells.
Masià A, Almazán-Moga A, Velasco P, Reventós J, Torán N, Sánchez de Toledo J, Roma J, Gallego S.
British Journal of Cancer 2012 Oct; 107(8):1374.
Application：IF, IHC-P, WB-Ce, WB-Tr, Human, CW9010, HTB82, RH30 cells, Human rhabdomyosarcoma tissues.
-
Osteopontin Is an Activator of Human Adipose Tissue Macrophages and Directly Affects Adipocyte Function.
Zeyda M, Gollinger K, Todoric J, Kiefer FW, Keck M, Aszmann O, Prager G, Zlabinger GJ, Petzelbauer P, Stulnig TM.
Endocrinology 2011 Jun; 152(6):2219.
Application：IHC-Fr, Human, Human intraabdominal adipose tissues.
-
Thrombin cleaved osteopontin regulates hemopoietic stem and progenitor cell functions through interactions with {alpha}9{beta}1 and {alpha}4{beta}1 integrins.
Grassinger J, Haylock DN, Storan MJ, Haines GO, Williams B, Whitty GA, Vinson AR, Be CL, Li S, Sorensen ES, Tam PP, Denhardt DT, Sheppard D, Choong PF, Nilsson SK.
Blood 2009 Jul; 114(1):49.
Application：IP, Human, Human hemopoietic stem cells.
-
An Interstitial Deletion at 3p21.3 Results in the Genetic Fusion of MLH1 and ITGA9 in a Lynch Syndrome Family.
Meyer C, Brieger A, Plotz G, Weber N, Passmann S, Dingermann T, Zeuzem S, Trojan J, Marschalek R.
Clinical Cancer Research 2009 Feb; 15(3):762.
Application：WB-Ce, Human, HEK 293T cells.
-
Integrin alpha9 emerges as a key therapeutic target to reduce metastasis in rhabdomyosarcoma and neuroblastoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com