ITGA7 monoclonal antibody (M01), clone 8G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ITGA7.
Immunogen
ITGA7 (NP_002197, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (73)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ITGA7 monoclonal antibody (M01), clone 8G2 Western Blot analysis of ITGA7 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITGA7 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ITGA7
Entrez GeneID
3679GeneBank Accession#
NM_002206Protein Accession#
NP_002197Gene Name
ITGA7
Gene Alias
FLJ25220
Gene Description
integrin, alpha 7
Omim ID
600536Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. They mediate a wide spectrum of cell-cell and cell-matrix interactions, and thus play a role in cell migration, morphologic development, differentiation, and metastasis. This protein functions as a receptor for the basement membrane protein laminin-1. It is mainly expressed in skeletal and cardiac muscles and may be involved in differentiation and migration processes during myogenesis. Defects in this gene are associated with congenital myopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq
Other Designations
integrin alpha 7|integrin alpha 7 chain
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Integrin α7β1 represses intestinal absorptive cell differentiation.
Gabriel Cloutier, Amira Seltana, Sepideh Fallah, Jean-François Beaulieu.
Experimental Cell Research 2023 Sep; 430(2):113723.
Application:WB-Ce, Human, Caco-2/15 cell.
-
Disease-modifying effects of orally bioavailable NF-κB inhibitors in dystrophin-deficient muscle.
Hammers DW, Sleeper MM, Forbes SC, Coker CC, Jirousek MR, Zimmer M, Walter GA, Sweeney HL.
JCI Insight 2016 Dec; 1(21):e90341.
Application:WB, Mouse, Mouse muscle.
-
Integrin α7β1 represses intestinal absorptive cell differentiation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com