ITGA4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ITGA4 partial ORF ( NP_000876, 98 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (87); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ITGA4
Entrez GeneID
3676GeneBank Accession#
NM_000885Protein Accession#
NP_000876Gene Name
ITGA4
Gene Alias
CD49D, IA4, MGC90518
Gene Description
integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
Omim ID
192975Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. [provided by RefSeq
Other Designations
269C wild type|antigen CD49D, alpha-4 subunit of VLA-4 receptor|integrin alpha 4|integrin alpha-4 subunit|very late activation protein 4 receptor, alpha 4 subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Complementarity determining regions and frameworks contribute to the disulfide bond independent folding of intrinsically stable scFv.
Gąciarz A, Ruddock LW.
PLoS One 2017 Dec; 12(12):e0189964.
Application:Dot, Recombinant protein.
-
Complementarity determining regions and frameworks contribute to the disulfide bond independent folding of intrinsically stable scFv.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com