Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITGA2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003673-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ITGA2 partial ORF (NP_002194.2, 30 a.a. - 119 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00003673-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3673
  • Gene Name:
  • ITGA2
  • Gene Alias:
  • BR,CD49B,GPIa,VLA-2,VLAA2
  • Gene Description:
  • integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
  • Gene Summary:
  • This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling. [provided by RefSeq
  • Other Designations:
  • integrin alpha 2,platelet antigen Br,platelet glycoprotein GPIa,platelet glycoprotein Ia,very late activation protein 2 receptor, alpha-2 subunit
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook