IRF3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IRF3 full-length ORF ( AAH09395, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALSRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKGKEGGVFDLGPFIVGSWAPRSDYLHGRKRTLTTLCPLVLCGGVMAPGPAVDQEARDGQGCAHVPQGLGRNGPGRGCLLPGEYCGPAHFQQPPTLPHLRPVQGLPAGLGGGHGFPGPWGDLSPRSSWCASNPPVPHHLNQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
75.24
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IRF3
Entrez GeneID
3661GeneBank Accession#
BC009395Protein Accession#
AAH09395Gene Name
IRF3
Gene Alias
-
Gene Description
interferon regulatory factor 3
Omim ID
603734Gene Ontology
HyperlinkGene Summary
IRF3 encodes interferon regulatory factor 3, a member of the interferon regulatory transcription factor (IRF) family. IRF3 is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The Golgi apparatus acts as a platform for TBK1 activation after viral RNA sensing.
Pourcelot M, Zemirli N, Silva Da Costa L, Loyant R, Garcin D, Vitour D, Munitic I, Vazquez A, Arnoult D.
BMC Biology 2016 Aug; 14:69.
Application:WB-Tr, Human, HEK293T cells.
-
Quantitation of the dynamic profiles of the innate immune response using multiplex selected reaction monitoring-mass spectrometry.
Zhao Y, Tian B, Edeh CB, Brasier AR.
Molecular & Cellular Proteomics 2013 Jun; 12(6):1513.
Application:Mass spectrometry, Human, A549 cells.
-
NEMO binds ubiquitinated TANK-binding kinase 1 (TBK1) to regulate innate immune responses to RNA viruses.
Wang L, Li S, Dorf ME.
PLoS One 2012 Sep; 7(9):e43756.
Application:KA, Human, HEK 293 cells.
-
Severe Acute Respiratory Syndrome Coronavirus M Protein Inhibits Type I Interferon Production by Impeding the Formation of TRAF3?PTANK?PTBK1/IKK{epsilon} Complex.
Siu KL, Kok KH, Ng MH, Poon VK, Yuen KY, Zheng BJ, Jin DY.
The Journal of Biological Chemistry 2009 Jun; 284(24):16202.
Application:KA, WB-Tr, Human, HEK 293 cells.
-
The Golgi apparatus acts as a platform for TBK1 activation after viral RNA sensing.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com