Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IRAK2 monoclonal antibody (M04), clone 1A6

  • Catalog # : H00003656-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant IRAK2.
  • Immunogen:
  • IRAK2 (NP_001561, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003656-M04
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IRAK2 monoclonal antibody (M04), clone 1A6 Western Blot analysis of IRAK2 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IRAK2 monoclonal antibody (M04), clone 1A6. Western Blot analysis of IRAK2 expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IRAK2 monoclonal antibody (M04), clone 1A6. Western Blot analysis of IRAK2 expression in NIH/3T3 ( Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged IRAK2 is approximately 0.03ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3656
  • Gene Name:
  • IRAK2
  • Gene Alias:
  • IRAK-2,MGC150550
  • Gene Description:
  • interleukin-1 receptor-associated kinase 2
  • Gene Summary:
  • IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. [provided by RefSeq
  • Other Designations:
  • interleukin-1 receptor associated kinase-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook