Product Browser

Last updated: 2017/11/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDX1 (Human) Recombinant Protein (P01)

  • Catalog # : H00003651-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDX1 full-length ORF ( AAI11593.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 58.08
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003651-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3651
  • Gene Name:
  • PDX1
  • Gene Alias:
  • GSF,IDX-1,IPF1,IUF1,MODY4,PDX-1,STF-1
  • Gene Description:
  • pancreatic and duodenal homeobox 1
  • Gene Summary:
  • The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018174,glucose-sensitive factor,insulin promoter factor 1, homeodomain transcription factor,insulin upstream factor 1,pancreatic-duodenal homeobox factor 1,somatostatin transcription factor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook