Product Browser

Last updated: 2017/2/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF3S6 polyclonal antibody (A01)

  • Catalog # : H00003646-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EIF3S6.
  • Immunogen:
  • EIF3S6 (NP_001559, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003646-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EIF3S6 polyclonal antibody (A01), Lot # 060814QCS1. Western Blot analysis of EIF3S6 expression in U-2 OS.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EIF3S6 polyclonal antibody (A01), Lot # 060111JC01 Western Blot analysis of EIF3S6 expression in Y-79 ( Cat # L042V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3646
  • Gene Name:
  • EIF3E
  • Gene Alias:
  • EIF3-P48,EIF3S6,INT6,eIF3-p46
  • Gene Description:
  • eukaryotic translation initiation factor 3, subunit E
  • Other Designations:
  • eukaryotic translation initiation factor 3, subunit 6 (48kD),eukaryotic translation initiation factor 3, subunit 6 48kDa,mammary tumor-associated protein INT6,murine mammary tumor integration site 6 (oncogene homolog)
  • RSS
  • YouTube
  • Linkedin
  • Facebook