INHBB polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant INHBB.
Immunogen
INHBB (NP_002184, 298 a.a. ~ 407 a.a) partial recombinant protein with GST tag.
Sequence
GRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
INHBB polyclonal antibody (A01), Lot # 060125JC01. Western Blot analysis of INHBB expression in human ovarian cancer.Western Blot (Recombinant protein)
ELISA
-
Gene Info — INHBB
Entrez GeneID
3625GeneBank Accession#
NM_002193Protein Accession#
NP_002184Gene Name
INHBB
Gene Alias
MGC157939
Gene Description
inhibin, beta B
Omim ID
147390Gene Ontology
HyperlinkGene Summary
The inhibin beta B subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta B subunit forms a homodimer, activin B, and also joins with the beta A subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. [provided by RefSeq
Other Designations
Inhibin, beta-2|activin AB beta polypeptide|inhibin beta B subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Autoantibody response against NALP5/MATER in primary ovarian insufficiency and in autoimmune Addison's disease.
Brozzetti A, Alimohammadi M, Morelli S, Minarelli V, Hallgren A, Giordano R, De Bellis A, Perniola R, Kampe O, Falorni A.
The Journal of Clinical Endocrinology and Metabolism 2015 May; 100(5):1941.
Application:RIA, Human, Serum.
-
Autoantibody response against NALP5/MATER in primary ovarian insufficiency and in autoimmune Addison's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com