Product Browser

Last updated: 2017/12/10
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ING1 polyclonal antibody (A01)

  • Catalog # : H00003621-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ING1.
  • Immunogen:
  • ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3621
  • Gene Name:
  • ING1
  • Gene Alias:
  • p24ING1c,p33,p33ING1,p33ING1b,p47,p47ING1a
  • Gene Description:
  • inhibitor of growth family, member 1
  • Gene Summary:
  • This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018703,OTTHUMP00000018704,OTTHUMP00000018705,OTTHUMP00000018706,growth inhibitor ING1,growth inhibitory protein ING1,inhibitor of growth 1,tumor suppressor ING1
  • RSS
  • YouTube
  • Linkedin
  • Facebook